Cat: PA1000-4808

Recombinant Human PPIL1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PPIL1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PPIL1;CYPL1;Peptidyl-prolyl cis-trans isomerase-like 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y3C6

  • Expression Region

    1-166aa

  • AA Sequence

    MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PPIL1 (Peptidyl-Prolyl Isomerase Like 1) is a member of the parvulin-type peptidyl-prolyl isomerase family, which plays a significant role in protein folding and cellular stress responses. Its involvement in various biological processes, including T cell activation, apoptosis, and cancer progression, has garnered attention in molecular biology and pharmacology. Recent research indicates that PPIL1 may function as a regulatory factor in cellular signaling pathways, influencing key cellular functions and contributing to disease mechanisms. The interest in PPIL1 is further heightened due to its potential as a therapeutic target; inhibiting its isomerase activity might offer novel strategies for treating diseases characterized by aberrant protein folding or autoimmune disorders. Investigating the structural and functional properties of recombinant PPIL1 protein can provide insights into its mechanism of action and facilitate the development of targeted therapies. As a recombinant protein, PPIL1 can be produced in microbial or mammalian systems, allowing for biochemical studies that elucidate its role in health and disease. Understanding PPIL1's multifaceted functions is crucial, as it may lead to breakthroughs in drug design and therapeutic interventions for conditions linked to dysregulated protein folding and immune responses. This research continues to be a significant focus within the fields of cellular biology, immunology, and therapeutic development, as the implications of PPIL1's functions extend to a wide range of pathological conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US