Analytical Data
-
Gene name
TUBB4A
- Application
-
Alternative Names
TUBB4A；TUBB4；TUBB5；Tubulin beta-4A chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P04350
-
Expression Region
1-444aa
-
AA Sequence
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA
-
Molecular Weight
53.6kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TUBB4A, a gene encoding the beta-tubulin isotype 4A, plays a critical role in the formation and stability of microtubules, which are essential components of the cytoskeleton in eukaryotic cells. Research on TUBB4A has gained significant attention due to its implications in various cellular processes, including cell division, intracellular transport, and maintaining cell shape. Mutations in the TUBB4A gene have been linked to a rare neurological disorder known as hypomyelination with atrophy of the basal ganglia and cerebellum (H-ABC), which manifests in symptoms such as developmental delays, motor deficits, and cognitive impairments. This has highlighted the importance of understanding TUBB4A's function and its role in microtubule dynamics. The recombinant production of TUBB4A protein allows scientists to study its biochemical properties, binding interactions, and the effects of pathological mutations in a controlled environment. Additionally, exploring TUBB4A protein dynamics can provide insights into cytoskeletal abnormalities associated with neurodegenerative diseases and other disorders. By utilizing various biochemical and biophysical techniques, researchers aim to elucidate the mechanisms underlying TUBB4A's role in cellular functions and its potential as a therapeutic target for neurological conditions.
