Cat: PA1000-4800

Recombinant Human TPH2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TPH2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TPH2;NTPH;Tryptophan 5-hydroxylase 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8IWU9

  • Expression Region

    151-466aa

  • AA Sequence

    VPWFPRKISELDKCSHRVLMYGSELDADHPGFKDNVYRQRRKYFVDVAMG YKYGQPIPRVEYTEEETKTWGVVFRELSKLYPTHACREYLKNFPLLTKYC GYREDNVPQLEDVSMFLKERSGFTVRPVAGYLSPRDFLAGLAYRVFHCTQ YIRHGSDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDED VQKLATCYFFTIEFGLCKQEGQLRAYGAGLLSSIGELKHALSDKACVKAF DPKTTCLQECLITTFQEAYFVSESFEEAKEKMRDFAKSITRPFSVYFNPY TQSIEILKDTRSIENV

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TPH2 (Tryptophan Hydroxylase 2) is a crucial enzyme involved in the biosynthesis of serotonin, a neurotransmitter that plays a significant role in mood regulation, anxiety, and various neuropsychiatric disorders. Mutations and alterations in TPH2 expression have been associated with psychiatric conditions such as depression, bipolar disorder, and schizophrenia, making it an important target for therapeutic interventions. The study of recombinant TPH2 proteins has gained momentum as researchers aim to understand the enzyme's structural and functional properties, which can provide insights into the mechanisms of serotonin synthesis and its regulation in the brain. Recombinant TPH2 proteins, produced through techniques such as recombinant DNA technology, enable detailed biochemical analyses, including enzyme kinetics, substrate specificity, and the effects of various modulators. Such studies contribute to the development of novel pharmacological agents that could potentially ameliorate serotonin-related disorders. Furthermore, investigating the recombinant forms of TPH2 aids in identifying the therapeutic potential of targeting serotonin pathways, thereby advancing our understanding of mental health conditions and offering new avenues for treatment.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US