Analytical Data
-
Gene name
SDC2
- Application
-
Alternative Names
SDC2；HSPG1；Syndecan-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P34741
-
Expression Region
32-130aa
-
AA Sequence
LDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTS AAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNV
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SDC2, or syndecan-2, is a type of cell surface heparan sulfate proteoglycan that plays a critical role in various physiological processes, including cell adhesion, migration, and signaling. Research into SDC2 recombinant proteins has gained traction due to their potential therapeutic applications in cancer, wound healing, and tissue regeneration. The SDC2 protein is known to interact with various growth factors and extracellular matrix components, influencing cellular responses and tissue homeostasis. Recent studies have suggested that manipulating SDC2 expression can impact tumor progression and metastasis, making it a significant focus in oncology research. Moreover, the ability to produce SDC2 as a recombinant protein allows for detailed functional studies and characterization of its interactions in vitro and in vivo. This recombinant approach facilitates the exploration of SDC2's roles in biological systems and its potential as a biomarker for disease states. Furthermore, understanding the structural and functional properties of SDC2 can aid in designing targeted therapeutic strategies, including drug delivery systems and regenerative medicine applications. Thus, the study of SDC2 recombinant proteins presents promising opportunities for advancing healthcare and therapeutic innovations.
