Analytical Data
-
Gene name
YKT6
- Application
-
Alternative Names
YKT6；Synaptobrevin homolog YKT6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15498
-
Expression Region
1-198aa
-
AA Sequence
MKLYSLSVLYKGEAKVVLLKAAYDVSSFSFFQRSSVQEFMTFTSQLIVER SSKGTRASVKEQDYLCHVYVRNDSLAGVVIADNEYPSRVAFTLLEKVLDE FSKQVDRIDWPVGSPATIHYPALDGHLSRYQNPREADPMTKVQAELDETK IILHNTMESLLERGEKLDDLVSKSEVLGTQSKAFYKTARKQNSCCAIMLD LQSR
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The YKT6 protein, a member of the Sec4/Rab family of small GTPases, plays a crucial role in the regulation of membrane trafficking and vesicle transport within eukaryotic cells. As a key player in the secretory pathway, YKT6 is involved in the fusion of transport vesicles with target membranes, facilitating the delivery of proteins and other molecules to their designated locations. Researchers have increasingly focused on YKT6 due to its importance in various cellular processes, including cell signaling, proliferation, and differentiation. Abnormalities in YKT6 function have been linked to several neurodegenerative diseases and cancers, making it a potential target for therapeutic intervention. Recent advances in structural biology techniques, such as X-ray crystallography and cryo-electron microscopy, have provided insights into the functional mechanisms of YKT6 at the molecular level. Understanding the role of YKT6 in cellular dynamics not only enhances our knowledge of fundamental biological processes but also opens avenues for developing new strategies in disease treatment and prevention. The ongoing studies on the recombinant production of YKT6 and its interactions with other cellular partners aim to elucidate its complex regulation and function within the cell.
