Analytical Data
-
Gene name
GAGE5
- Application
-
Alternative Names
GAGE5;G antigen 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13069
-
Expression Region
1-117aa
-
AA Sequence
MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC
-
Molecular Weight
39.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The GAGE (G antigen) family, particularly GAGE5, has garnered considerable attention in cancer immunology due to its potential as a tumor-associated antigen (TAA). The GAGE genes are located on the X chromosome and are known for their restricted expression primarily in germ cells and certain malignant tissues, making them promising targets for cancer immunotherapy. As a member of this family, GAGE5 is implicated in various malignancies, including melanoma, and is associated with the activation of T-cell responses. This characteristic renders it an attractive candidate for the development of cancer vaccines and immunotherapeutic strategies aimed at harnessing the body's immune system to recognize and destroy tumor cells. Research into GAGE5 not only focuses on its expression patterns and biological functions but also explores its potential as a biomarker for cancer diagnosis and prognosis. The recombinant protein form of GAGE5 is extensively studied to elucidate its immunogenic properties and to develop peptide-based vaccines that can elicit strong immune responses in cancer patients. Advances in understanding the role of GAGE5 in tumor immunity could facilitate the design of more effective cancer therapies, ultimately improving patient outcomes in oncology.











