Analytical Data
-
Gene name
FCER1G
- Application
-
Alternative Names
FCER1G；High affinity immunoglobulin epsilon receptor subunit gamma
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30273
-
Expression Region
45-86aa
-
AA Sequence
RLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
-
Molecular Weight
6.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FCER1G, the gene encoding the Fc receptor gamma chain, plays a crucial role in the immune response by forming a part of various immunoreceptors, including FcεRI and FcγR. These receptors are pivotal in mediating allergic reactions, autoimmune diseases, and responses to infections. Research on FCER1G recombinant protein is integral for understanding its biochemical properties, signaling pathways, and interactions with ligands such as immunoglobulin E (IgE) and immunoglobulin G (IgG). By producing FCER1G as a recombinant protein, scientists can study its structural and functional dynamics, which is essential for elucidating its role in mast cell activation and degranulation. This research has clinical implications, particularly in developing targeted therapies for allergic diseases and other immune-related disorders. Moreover, advances in recombinant DNA technology and protein engineering facilitate the generation of functional variants of FCER1G, potentially leading to novel therapeutic agents. Understanding the role of FCER1G may also provide insights into the broader context of immune system regulation and its implications in health and disease.
