Cat: PA2000-1995

Recombinant Human FCER1G Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FCER1G

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FCER1G;High affinity immunoglobulin epsilon receptor subunit gamma

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P30273

  • Expression Region

    45-86aa

  • AA Sequence

    RLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ

  • Molecular Weight

    6.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FCER1G, the gene encoding the Fc receptor gamma chain, plays a crucial role in the immune response by forming a part of various immunoreceptors, including FcεRI and FcγR. These receptors are pivotal in mediating allergic reactions, autoimmune diseases, and responses to infections. Research on FCER1G recombinant protein is integral for understanding its biochemical properties, signaling pathways, and interactions with ligands such as immunoglobulin E (IgE) and immunoglobulin G (IgG). By producing FCER1G as a recombinant protein, scientists can study its structural and functional dynamics, which is essential for elucidating its role in mast cell activation and degranulation. This research has clinical implications, particularly in developing targeted therapies for allergic diseases and other immune-related disorders. Moreover, advances in recombinant DNA technology and protein engineering facilitate the generation of functional variants of FCER1G, potentially leading to novel therapeutic agents. Understanding the role of FCER1G may also provide insights into the broader context of immune system regulation and its implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US