Cat: PA2000-1993

Recombinant Human FBXL18 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FBXL18

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FBXL18;FBL18;F-box/LRR-repeat Protein 18

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96ME1

  • Expression Region

    1-365aa

  • AA Sequence

    MASSGEDISNDDDDMHPAAAGMADGVHLLGFSDEILLHILSHVPSTDLILNVRRTCRKLAALCLDKSLIHTVLLQKDYQASEDKVRQLVKEIGREIQQLSMAGCYWLPGSTVEHVARCRSLVKVNLSGCHLTSLRLSKMLSALQHLRSLAIDVSPGFDASQLSSECKATLSRVRELKQTLFTPSYGVVPCCTSLEKLLLYFEILDRTREGAILSGQLMVGQSNVPHYQNLRVFYARLAPGYINQEVVRLYLAVLSDRTPQNLHAFLISVPGSFAESGATKNLLDSMARNVVLDALQLPKSWLNGSSLLQHMKFNNPFYFSFSRCTLSGGHLIQQVINGGKDLRSLASLNLSGCVHCLSPDSLLCR

  • Molecular Weight

    56.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FBXL18 is a member of the F-box protein family, which plays a crucial role in ubiquitin-mediated protein degradation, a vital cellular process that regulates various biological functions, including cell cycle progression, signal transduction, and apoptosis. Recent studies have suggested that FBXL18 may be involved in developmental processes and cancer progression. Researchers have been interested in its role as a substrate adaptor for the SCF (Skp1-Cul1-F-box) ubiquitin ligase complex, potentially regulating the degradation of specific target proteins that influence cell proliferation and differentiation. The protein's expression profile in different tissues and its interaction with other cellular pathways indicate its significance in maintaining cellular homeostasis. Furthermore, aberrant expression of FBXL18 has been linked to several malignancies, making it a potential biomarker for disease progression and a therapeutic target. As such, producing recombinant FBXL18 protein is critical for investigating its structural properties, functional mechanisms, and interactions with other proteins. Understanding FBXL18's biology could elucidate its role in physiological processes and its potential contributions to pathological conditions, paving the way for novel therapeutic strategies. Researchers are currently focusing on characterizing FBXL18's function in various cellular contexts, its regulatory mechanisms, and the implications of its dysregulation in diseases, especially cancer. This comprehensive exploration of FBXL18 could offer insights into innovative treatments that leverage the modulation of ubiquitin-mediated pathways to restore normal cellular functions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US