Analytical Data
-
Gene name
OLR1 / LOX1
- Application
-
Alternative Names
OLR1 / LOX1；nadA3；Neisseria adhesin A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P78380
-
Expression Region
61-273aa
-
AA Sequence
SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLA RKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSS GSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRN PSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAA FSICQKKANLRAQVDHHHHHH
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on OLR1 (Oxidized Low-Density Lipoprotein Receptor 1) and LOX1 (Lectin-like Oxidized Low-Density Lipoprotein Receptor 1) recombinant proteins is driven by their critical roles in lipid metabolism and atherogenesis. OLR1, primarily expressed in endothelial cells, binds to oxidized low-density lipoproteins (oxLDL), facilitating cellular uptake and contributing to foam cell formation, a key event in atherosclerosis. LOX1, also a receptor for oxLDL, plays a significant role in inflammatory responses and cardiovascular diseases. Both proteins are implicated in various pathological conditions, including cardiovascular diseases, diabetes, and neurodegenerative disorders. Understanding the molecular mechanisms and interactions of these receptors through recombinant protein studies can elucidate their functions and contributions to disease processes. This research is essential for identifying potential therapeutic targets and developing novel strategies to mitigate atherosclerosis and its associated complications. By examining the structural characteristics, ligand interactions, and signaling pathways of OLR1 and LOX1, scientists aim to uncover their roles in cell signaling and disease progression, ultimately aiming to provide new insights into cardiovascular health and disease management.
