Cat: PA1000-4614

Recombinant Human OLR1 / LOX1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OLR1 / LOX1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OLR1 / LOX1;nadA3;Neisseria adhesin A

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P78380

  • Expression Region

    61-273aa

  • AA Sequence

    SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLA RKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSS GSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRN PSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAA FSICQKKANLRAQVDHHHHHH

  • Molecular Weight

    25 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The research on OLR1 (Oxidized Low-Density Lipoprotein Receptor 1) and LOX1 (Lectin-like Oxidized Low-Density Lipoprotein Receptor 1) recombinant proteins is driven by their critical roles in lipid metabolism and atherogenesis. OLR1, primarily expressed in endothelial cells, binds to oxidized low-density lipoproteins (oxLDL), facilitating cellular uptake and contributing to foam cell formation, a key event in atherosclerosis. LOX1, also a receptor for oxLDL, plays a significant role in inflammatory responses and cardiovascular diseases. Both proteins are implicated in various pathological conditions, including cardiovascular diseases, diabetes, and neurodegenerative disorders. Understanding the molecular mechanisms and interactions of these receptors through recombinant protein studies can elucidate their functions and contributions to disease processes. This research is essential for identifying potential therapeutic targets and developing novel strategies to mitigate atherosclerosis and its associated complications. By examining the structural characteristics, ligand interactions, and signaling pathways of OLR1 and LOX1, scientists aim to uncover their roles in cell signaling and disease progression, ultimately aiming to provide new insights into cardiovascular health and disease management.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US