Cat: PA1000-4507

Recombinant Human CPA1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CPA1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CPA1;CPA;Carboxypeptidase A1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P15085

  • Expression Region

    17-419aa

  • AA Sequence

    KEDFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVR VPFPSIQAVKIFLESHGISYETMIEDVQSLLDEEQEQMFAFRSRARSTDT FNYATYHTLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIYVLKFSTGG SKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIF LEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNRNWDAGFGLSGA SSNPCSETYRGKFANSEVEVKSIVDFVKDHGNIKAFISIHSYSQLLMYPY GYKTEPVPDQDELDQLSKAAVTALASLYGTKFNYGSIIKAIYQASGSTID WTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLALLTIMEHTLN HPYVDHHHHHH

  • Molecular Weight

    47 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CPA1, or carboxypeptidase A1, is a digestive enzyme predominantly secreted by the pancreas that plays a crucial role in the final stages of protein digestion. The study of CPA1 and its recombinant forms has gained significant attention due to its potential applications in both basic research and therapeutic development. Understanding the structure and function of CPA1 can provide insights into enzymatic mechanisms, protein processing, and the regulation of digestive pathways. In pathological conditions, such as pancreatic disorders, the activity and expression of CPA1 might be altered, leading to digestive challenges and other health complications. The recombinant production of CPA1 allows researchers to study its properties in detail, explore its substrate specificity, and assess its interactions with inhibitors and activators. Furthermore, recombinant CPA1 can serve as a valuable tool in protein engineering and biotechnology, aiding the development of novel therapeutics or diagnostic tools. The ability to produce this enzyme in a controlled manner opens avenues for investigating its role in various biological systems and could lead to industrial applications where CPA1 is utilized for protein processing or biocatalysis. Thus, the research on CPA1 not only contributes to a deeper understanding of digestive biology but also holds promise for advancing medical and biotechnological innovations.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US