Cat: PA2000-1957

Recombinant Human CYP11B2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CYP11B2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CYP11B2;Cytochrome P450 11B2. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P19099

  • Expression Region

    25-503aa

  • AA Sequence

    GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQE LGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRG HKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKK KVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFL HALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKI YQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLL MTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLR LYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYN PQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVE TLTQEDIKMVYSFILRPGTSPLLTFRAIN

  • Molecular Weight

    71 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CYP11B2, also known as aldosterone synthase, is a pivotal enzyme in the steroidogenic pathway, specifically responsible for the biosynthesis of aldosterone in the adrenal cortex. Its activity plays a crucial role in regulating electrolyte balance and blood pressure by promoting sodium retention and potassium excretion. Dysregulation of CYP11B2 is linked to various health conditions, including hypertension and heart failure, making it a key target for therapeutic intervention. The study of recombinant CYP11B2 protein is essential for understanding its enzymatic function and regulatory mechanisms. Producing this protein through recombinant DNA technology allows researchers to obtain large quantities of pure enzyme for in vitro studies, facilitating investigations into its kinetic properties, substrate specificity, and interaction with various inhibitors. Furthermore, recombinant CYP11B2 can be utilized in drug screening assays aimed at developing novel antihypertensive agents. Understanding the molecular dynamics and structural characteristics of CYP11B2 can also provide insights into its role in pathology and pave the way for targeted therapies against diseases associated with aldosterone dysregulation. Overall, the research on recombinant CYP11B2 not only enhances our comprehension of steroid metabolism but also holds significant potential for advancing cardiovascular disease management.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US