Cat: PA2000-1956

Recombinant Human CXCL5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CXCL5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CXCL5;ENA78;SCYB5;C-X-C motif chemokine 5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P42830

  • Expression Region

    41-114aa

  • AA Sequence

    AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEI CLDPEAPFLKKVIQKILDGGNKEN

  • Molecular Weight

    8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CXCL5, also known as chemokine (C-X-C motif) ligand 5 or ENA-78, is a member of the CXC chemokine family that plays a critical role in immune response and inflammation. It primarily functions as a chemotactic factor for neutrophils and other immune cells, influencing their migration to sites of inflammation and injury. Elevated levels of CXCL5 have been associated with various pathological conditions, including autoimmune diseases, cancer, and chronic inflammatory disorders. Recent studies have highlighted its potential role in tumor progression and metastasis, as it can modulate the tumor microenvironment and promote angiogenesis. Given these significant implications, recombinant CXCL5 proteins have become a focus of research for therapeutic applications and biomarker development. By producing CXCL5 in a recombinant form, researchers aim to investigate its biological activities, interactions with other cytokines, and signaling pathways involved in immune regulation. Understanding the function of CXCL5 at a molecular level could provide insights into its role in disease processes and unveil novel therapeutic strategies aimed at targeting this chemokine for improved clinical outcomes. Consequently, the characterization and functional analysis of CXCL5-recombinant proteins are essential for progressing our knowledge of immune mechanisms and developing targeted treatments for inflammatory and oncological diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US