Analytical Data
-
Gene name
CXCL5
- Application
-
Alternative Names
CXCL5；ENA78；SCYB5；C-X-C motif chemokine 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P42830
-
Expression Region
41-114aa
-
AA Sequence
AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEI CLDPEAPFLKKVIQKILDGGNKEN
-
Molecular Weight
8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CXCL5, also known as chemokine (C-X-C motif) ligand 5 or ENA-78, is a member of the CXC chemokine family that plays a critical role in immune response and inflammation. It primarily functions as a chemotactic factor for neutrophils and other immune cells, influencing their migration to sites of inflammation and injury. Elevated levels of CXCL5 have been associated with various pathological conditions, including autoimmune diseases, cancer, and chronic inflammatory disorders. Recent studies have highlighted its potential role in tumor progression and metastasis, as it can modulate the tumor microenvironment and promote angiogenesis. Given these significant implications, recombinant CXCL5 proteins have become a focus of research for therapeutic applications and biomarker development. By producing CXCL5 in a recombinant form, researchers aim to investigate its biological activities, interactions with other cytokines, and signaling pathways involved in immune regulation. Understanding the function of CXCL5 at a molecular level could provide insights into its role in disease processes and unveil novel therapeutic strategies aimed at targeting this chemokine for improved clinical outcomes. Consequently, the characterization and functional analysis of CXCL5-recombinant proteins are essential for progressing our knowledge of immune mechanisms and developing targeted treatments for inflammatory and oncological diseases.
