Cat: PA1000-4506

Recombinant Human CES1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CES1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CES1;ADGF;CECR1;IDGFL;Adenosine deaminase 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P23141-3

  • Expression Region

    19-562aa

  • AA Sequence

    GHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTP PQPAEPWSFVKNATSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCL YLNIYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVT IQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIASFGGNPGSVTI FGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEQ IAITAGCKTTTSAVMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQP LLGTVIDGMLLLKTPEELQAERNFHTVPYMVGINKQEFGWLIPMLMSYPL SEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTVKKKDLFL DLIADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDH GDELFSVFGAPFLKEGASEEEIRLSKMVMKFWANFARNGNPNGEGLPHWP EYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQTEVDHHH HHH

  • Molecular Weight

    61 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CES1 (carboxylesterase 1) is an important enzyme that plays a crucial role in the hydrolysis of various esters, including pharmaceutical compounds and environmental pollutants. Its research background stems from the growing need to understand biotransformation processes, particularly in the context of drug metabolism and toxicology. CES1 is primarily expressed in the liver and is involved in the metabolism of prodrugs, which are converted into active drugs through enzymatic activity. This makes CES1 a key player in pharmacokinetics, influencing drug efficacy and safety. Moreover, variations in CES1 expression and activity can be linked to genetic polymorphisms, leading to interindividual differences in drug response. Consequently, studying CES1 not only aids in the development of effective therapeutic agents but also helps in assessing risks associated with exposure to harmful substances. Recent advancements in proteomics and molecular biology have enabled researchers to explore the structural and functional characteristics of CES1, facilitating the identification of potential inhibitors and substrates. As a result, understanding CES1 offers valuable insights into personalized medicine, environmental remediation, and the design of safer pharmaceuticals, highlighting its significance in both clinical and environmental contexts. The ongoing research into CES1 and its role in various biological processes continues to expand our comprehension of enzyme function and its implications for human health and environmental sustainability.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US