Cat: PA1000-4497

Recombinant Human FGF8B Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FGF8B

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FGF8B;Fgf8b;Fibroblast growth factor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P55075-3

  • Expression Region

    23-215aa

  • AA Sequence

    QVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKR INAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNG KGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREV HFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

  • Molecular Weight

    22 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Fibroblast Growth Factor 8B (FGF8B) is part of the fibroblast growth factor (FGF) family, which plays a crucial role in various biological processes, including cell proliferation, differentiation, and embryonic development. The interest in FGF8B has significantly increased due to its involvement in important physiological and pathological processes, such as angiogenesis, wound healing, and the development of certain cancers. Research has demonstrated that FGF8B exerts its effects by signaling through the FGF receptors, activating downstream pathways that are pivotal for cellular functions. Furthermore, aberrations in FGF signaling are associated with various developmental disorders and tumorigenesis, making FGF8B a potential target for therapeutic intervention. The generation and characterization of recombinant FGF8B protein offers valuable insights into its biological functions and mechanisms of action, facilitating the study of its role in health and disease. Additionally, as a result of its potential applications in regenerative medicine and tissue engineering, the investigation of FGF8B has broad implications for developing novel therapeutic strategies. Thus, ongoing research on recombinant FGF8B not only contributes to the understanding of its biological significance but also paves the way for its application in clinical settings.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US