Cat: PA2000-1949

Recombinant Human CTAG2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CTAG2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CTAG2;ESO2;LAGE1;Cancer/testis antigen 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O75638

  • Expression Region

    1-210aa

  • AA Sequence

    MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI

  • Molecular Weight

    28.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CTAG2 (Cancer/Testis Antigen 2) is a member of the cancer/testis antigen family, which is typically expressed in various cancers and in the germ cells of the testis, but not in normal somatic tissues. This unique expression pattern makes CTAG2 a promising target for cancer immunotherapy, particularly in the development of vaccines and T-cell therapies. Recent studies have indicated that CTAG2 may play a crucial role in tumor progression and immune evasion, further highlighting its potential as a biomarker for cancer diagnosis and prognosis. The recombinant expression of CTAG2 protein has facilitated the exploration of its immunogenicity and the development of targeted therapies aimed at eliciting an immune response against tumors expressing this antigen. Researchers are investigating the potential of CTAG2 as a therapeutic target, particularly in melanoma and other malignancies where its expression is prevalent. Understanding the structure and function of CTAG2 could lead to significant advancements in personalized medicine, offering new avenues for treatment in patients with advanced cancers. Furthermore, the study of CTAG2 may contribute to the broader understanding of tumor-specific antigens and their mechanisms in facilitating immune responses, potentially paving the way for more effective immunotherapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US