Analytical Data
-
Gene name
CTAG2
- Application
-
Alternative Names
CTAG2；ESO2；LAGE1；Cancer/testis antigen 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75638
-
Expression Region
1-210aa
-
AA Sequence
MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI
-
Molecular Weight
28.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CTAG2 (Cancer/Testis Antigen 2) is a member of the cancer/testis antigen family, which is typically expressed in various cancers and in the germ cells of the testis, but not in normal somatic tissues. This unique expression pattern makes CTAG2 a promising target for cancer immunotherapy, particularly in the development of vaccines and T-cell therapies. Recent studies have indicated that CTAG2 may play a crucial role in tumor progression and immune evasion, further highlighting its potential as a biomarker for cancer diagnosis and prognosis. The recombinant expression of CTAG2 protein has facilitated the exploration of its immunogenicity and the development of targeted therapies aimed at eliciting an immune response against tumors expressing this antigen. Researchers are investigating the potential of CTAG2 as a therapeutic target, particularly in melanoma and other malignancies where its expression is prevalent. Understanding the structure and function of CTAG2 could lead to significant advancements in personalized medicine, offering new avenues for treatment in patients with advanced cancers. Furthermore, the study of CTAG2 may contribute to the broader understanding of tumor-specific antigens and their mechanisms in facilitating immune responses, potentially paving the way for more effective immunotherapeutic strategies.
