Analytical Data
-
Gene name
CTAG1A
- Application
-
Alternative Names
CTAG1A；CTAG；CTAG1；ESO1；Cancer/testis antigen 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P78358
-
Expression Region
1-180aa
-
AA Sequence
MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGA ARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPM EAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSIS SCLQQLSLLMWITQCFLPVFLAQPPSGQRR
-
Molecular Weight
48 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CTAG1A (Cancer/Testis Antigen 1A) is a protein that has garnered significant attention in cancer research due to its unique expression pattern, being predominantly found in testicular germ cells and certain types of tumors, particularly melanoma and various carcinomas. The aberrant expression of CTAG1A in tumors makes it a potential biomarker for cancer diagnosis and a promising target for immunotherapy. Understanding the structure and function of CTAG1A is crucial for developing therapeutic strategies, as it may elicit a strong immune response. Recent studies have focused on the recombinant expression of CTAG1A to investigate its molecular characteristics, evaluate its immunogenic potential, and explore its role in tumorigenesis. Recombinant CTAG1A is produced using various expression systems, allowing researchers to study its interactions with immune cells and assess its capability to stimulate specific T-cell responses. Such insights could lead to novel cancer vaccines or immune checkpoint therapies, improving patient outcomes in cancer treatment. The ongoing research into CTAG1A underscores its significance as not only a biological marker for tumors but also as a critical component in the evolving landscape of cancer immunotherapy. As the field of personalized medicine progresses, CTAG1A's role will likely expand, contributing to more targeted and effective therapeutic approaches for patients with cancers expressing this antigen.
