Cat: PA2000-1948

Recombinant Human CTAG1A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CTAG1A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CTAG1A;CTAG;CTAG1;ESO1;Cancer/testis antigen 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P78358

  • Expression Region

    1-180aa

  • AA Sequence

    MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGA ARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPM EAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSIS SCLQQLSLLMWITQCFLPVFLAQPPSGQRR

  • Molecular Weight

    48 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CTAG1A (Cancer/Testis Antigen 1A) is a protein that has garnered significant attention in cancer research due to its unique expression pattern, being predominantly found in testicular germ cells and certain types of tumors, particularly melanoma and various carcinomas. The aberrant expression of CTAG1A in tumors makes it a potential biomarker for cancer diagnosis and a promising target for immunotherapy. Understanding the structure and function of CTAG1A is crucial for developing therapeutic strategies, as it may elicit a strong immune response. Recent studies have focused on the recombinant expression of CTAG1A to investigate its molecular characteristics, evaluate its immunogenic potential, and explore its role in tumorigenesis. Recombinant CTAG1A is produced using various expression systems, allowing researchers to study its interactions with immune cells and assess its capability to stimulate specific T-cell responses. Such insights could lead to novel cancer vaccines or immune checkpoint therapies, improving patient outcomes in cancer treatment. The ongoing research into CTAG1A underscores its significance as not only a biological marker for tumors but also as a critical component in the evolving landscape of cancer immunotherapy. As the field of personalized medicine progresses, CTAG1A's role will likely expand, contributing to more targeted and effective therapeutic approaches for patients with cancers expressing this antigen.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US