Cat: PA1000-4466

Recombinant Human LACTB2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LACTB2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    LACTB2;Endoribonuclease LACTB2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q53H82

  • Expression Region

    1-288aa

  • AA Sequence

    MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEP AIPEYISCLK QALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTT YCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDD HMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPG HGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKN TPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL

  • Molecular Weight

    33 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LACTB2, also known as Lactamase Beta 2, is a protein that has garnered considerable interest in recent years due to its potential roles in cellular processes and disease mechanisms. It is a member of the larger lactamase enzyme family, which is primarily known for its function in antibiotic resistance; however, LACTB2's involvement extends beyond this activity. Recent studies suggest that LACTB2 plays a significant role in regulating cellular metabolism, apoptosis, and proliferation, making it a critical factor in cancer biology and other pathological conditions. Its expression has been linked to various cancers, where altered levels of LACTB2 may influence tumor growth and response to therapies. Furthermore, as a mitochondrial protein, LACTB2 is implicated in maintaining mitochondrial function and homeostasis, adding another layer of complexity to its biological significance. Investigating the structure and function of recombinant LACTB2 can provide valuable insights into its enzymatic mechanisms and interactions with other cellular components. This research not only enhances our understanding of LACTB2's biological roles but also opens up new avenues for therapeutic interventions in diseases where LACTB2 is dysregulated. As a result, recombinant LACTB2 serves as a crucial target for ongoing studies aimed at elucidating its full range of functions and potential applications in biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US