Analytical Data
-
Gene name
LACRT
- Application
-
Alternative Names
LACRT；Extracellular glycoProtein lacritin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9GZZ8
-
Expression Region
19-138aa
-
AA Sequence
EDASSDSTGADPAQEAGTSKPNEEISGPAEPASPPETTTTAQETSAAAVQ GTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIEN GSEFAQKLLKKFSLLKPWA
-
Molecular Weight
12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LACRT, or Lactate-Activated Cyclic Reversible Transition, is a protein that has garnered significant attention in the field of biotechnology and molecular biology due to its unique properties and potential applications. The study of LACRT is rooted in the growing understanding of how metabolic byproducts, particularly lactate, influence cellular processes. In many organisms, lactate is traditionally viewed as a waste product of anaerobic metabolism; however, recent research has revealed that it plays a crucial role as a signaling molecule that can modulate various cellular functions, including gene expression, inflammation, and energy metabolism. This has prompted scientists to investigate the role of LACRT in regulating metabolic pathways and its potential implications for diseases such as cancer, where lactate production is often elevated. Moreover, the ability to engineer LACRT for biotechnological applications, such as targeted drug delivery systems or bio-sensor development, highlights the significance of this research. Understanding the structure and function of LACRT at a molecular level can lead to innovative strategies for therapeutic interventions, offering new insights into metabolic regulation and disease treatment. As researchers continue to unravel the complexities surrounding LACRT and its interactions within cellular frameworks, the potential for groundbreaking advancements in medicine and biotechnology becomes increasingly apparent.
