Analytical Data
-
Gene name
C14orf181
- Application
-
Alternative Names
Cluster: LOW QUALITY Protein: putative uncharacterized Protein C14orf181
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N912
-
Expression Region
1-166 aa
-
AA Sequence
MNTYTRSASFTPKTFTFPLAQNRTSHPTTTSKLKYLGRPSPRRDALQANGEGPEVGPGTEEPAHRLPVGSGSAGEAAASLGTARVRSGRAECTAKLAGDGHARLASAFLHRRAALPPPLGTCRPRLGEGGSAPALGPSPRRGRRVSEGLRDSLPPLGSLTLGKSPK
-
Molecular Weight
45.21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C14orf181, also known as KIAA1220, is a gene located on chromosome 14 that has recently gained attention in biomedical research due to its potential roles in various cellular processes and diseases. Though its precise biological function remains largely undetermined, preliminary studies suggest it may be involved in cellular signaling, proliferation, and differentiation. Its expression patterns have been observed in multiple tissues, indicating its potential significance in human health. Recent investigations have focused on characterizing C14orf181 recombinant proteins to understand their structural and functional properties. These efforts include the production of the protein in suitable expression systems, followed by purification and functional assays. The study of C14orf181 recombinant proteins aims to elucidate their interactions with other molecular partners, which could help clarify their roles in pathological conditions, including cancer and developmental disorders. This research is essential for determining the potential of C14orf181 as a biomarker or therapeutic target, paving the way for novel approaches in treating diseases associated with its dysregulation.
