Analytical Data
-
Gene name
GC
- Application
-
Alternative Names
GC；Vitamin D-binding Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02774
-
Expression Region
1-474aa
-
AA Sequence
MKRVLVLLLAVAFGHALERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on GC (Germplasm Center) recombinant proteins is grounded in the increasing demand for novel therapeutic agents and the need for improved understanding of protein function and interactions within biological systems. GC recombinant proteins are engineered variants created through genetic manipulation, allowing for the production of proteins with enhanced properties or functions. This research plays a pivotal role in various fields, including medicine, agriculture, and biotechnology, as it enables the development of more effective vaccines, antibodies, and enzymes. Moreover, recombinant proteins can be utilized to study disease mechanisms, elucidate cellular pathways, and facilitate drug discovery processes. The advancements in genetic engineering and expression systems, paired with high-throughput screening techniques, have accelerated the identification and optimization of these proteins. Understanding the structure-function relationship of GC recombinant proteins not only enhances their practical applications but also contributes to fundamental biological knowledge. As the world faces challenges such as emerging infectious diseases and agricultural sustainability, the study of GC recombinant proteins offers promising avenues for innovative solutions that are crucial for global health and food security.
