Analytical Data
-
Gene name
C14orf153
- Application
-
Alternative Names
APOP-1; APOP1; APOP1_HUMAN; Apopt1; Apoptogenic 1 mitochondrial; Apoptogenic Protein 1; Apoptogenic Protein 1 mitochondrial; C14orf153; mitochondrial; UPF0671 Protein C14orf153
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96IL0
-
Expression Region
1-193 aa
-
AA Sequence
MVVLRAGKKTFLPALCRAFACRGCQLAPERGAERRDTAPSGVSRFCPPRKSCHDWIGPPDKYSNLRPVHFYIPENESPLEQKLRKLRQETQEWNQQFWANQNLTFSKEKEEFIHSRLKTKGLGLRTESGQKATLNAEEMADFYKEFLSKNFQKHMYYNRDWYKRNFAITFFMGKVALERIWNKLKQKQKKRSN
-
Molecular Weight
49.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C14orf153, also known as LINC00472, is a gene located on chromosome 14 that has gained attention in recent years due to its potential roles in various biological processes and diseases. Initially identified through genomic studies, C14orf153 is believed to participate in regulatory networks, influencing cellular responses and function. Its expression has been linked to several conditions, including various cancers, making it a target for therapeutic research. The study of C14orf153 recombinant proteins enables the exploration of its functional properties and interactions at the molecular level. By producing these proteins in controlled laboratory settings, researchers can investigate their biochemical activities, receptors, and pathways involved in cellular communication and gene regulation. Moreover, the recombinant C14orf153 proteins serve as valuable tools for the development of diagnostic and therapeutic strategies, allowing for the potential targeting of associated pathways in disease. Understanding the roles of C14orf153 and its protein products can lead to novel insights into disease mechanisms and the development of innovative treatment options, highlighting the importance of continuing research in this area.
