Analytical Data
-
Gene name
KLKB1
- Application
-
Alternative Names
KLKB1；KLK3；Plasma kallikrein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P03952
-
Expression Region
20-390aa
-
AA Sequence
GCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTR
-
Molecular Weight
43.4kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KLKB1, the gene encoding the plasma kallikrein protein, plays a crucial role in the kallikrein-kinin system, which is involved in various physiological processes including blood pressure regulation, inflammation, and pain. Dysregulation of KLKB1 has been implicated in several cardiovascular and inflammatory diseases, making it a significant target for therapeutic intervention. Research into KLKB1 recombinant proteins focuses on understanding its structure-function relationship and elucidating its role in physiological and pathological states. Recombinant KLKB1 can be produced in various expression systems, allowing for the analysis of its biochemical properties, enzymatic activity, and interactions with other proteins. This research is vital for developing novel treatments for conditions associated with KLKB1 dysregulation, such as hereditary angioedema and other thrombotic disorders. Moreover, studying KLKB1 recombinant protein offers insights into its potential roles in cancer progression and autoimmune diseases, positioning it as a promising candidate for drug development and biomarker discovery. Advances in recombinant DNA technology have enabled the generation of KLKB1 protein variants, which can be used to investigate the effects of specific mutations and post-translational modifications on its activity. This research not only enhances our understanding of KLKB1's biological functions but also opens avenues for innovative therapeutic strategies targeting the kallikrein-kinin system. In summary, KLKB1 recombinant protein research is a dynamic field aimed at unraveling complex biological interactions and developing novel clinical applications.
