Analytical Data
-
Gene name
ATP6V0D1
- Application
-
Alternative Names
ATP6V0D1；C14orf9；TMEM55B；Type 1 phosphatidylinositol 4.5-bisphosphate 4-phosphatase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P61421
-
Expression Region
1-351aa
-
AA Sequence
MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
-
Molecular Weight
50.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATP6V0D1, a subunit of the vacuolar ATPase (V-ATPase) complex, plays a crucial role in acidifying intracellular compartments, thereby regulating various cellular processes, including protein degradation, nutrient sensing, and vesicular trafficking. Research on ATP6V0D1 has gained prominence due to its involvement in several pathophysiological conditions, such as cancer, neurodegenerative diseases, and metabolic disorders. Recent studies have suggested that alterations in the expression or function of ATP6V0D1 can affect the overall activity of V-ATPase, leading to disrupted cellular homeostasis. The understanding of ATP6V0D1's role at the molecular level can provide insights into its function in health and disease, highlighting its potential as a therapeutic target. Furthermore, the development of recombinant ATP6V0D1 protein enhances the ability to study its biochemical properties, interactions with other cellular components, and its potential as a biomarker. Consequently, ongoing research focuses on elucidating the precise mechanisms by which ATP6V0D1 contributes to cellular function and its implications in various diseases.
