Analytical Data
-
Gene name
AP1S3
- Application
-
Alternative Names
AP1S3；AP-1 complex subunit sigma-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96PC3
-
Expression Region
1-104aa
-
AA Sequence
MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNTWPFARA
-
Molecular Weight
39.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AP1S3, a component of the adaptor protein complex 1 (AP-1), plays a critical role in intracellular transport and sorting of transmembrane proteins. As a key player in the clathrin-mediated endocytic pathway, AP1S3 is involved in the retrieval of proteins from the trans-Golgi network to lysosomes, which is essential for maintaining cellular homeostasis and function. Dysregulation of AP1S3 has been linked to various diseases, including metabolic disorders and cancer, making it a significant focus of biomedical research. Recent studies have highlighted its potential role in modulating signaling pathways, influencing cell proliferation, and apoptosis. Understanding the structural and functional characteristics of AP1S3 can provide insights into its mechanisms in health and disease. Furthermore, research into recombinant AP1S3 protein offers opportunities for developing therapeutic strategies targeting its function, contributing to the broader field of molecular biology and biotechnology. Investigating AP1S3 can unravel novel interactions and pathways, contributing to our knowledge of cellular transport mechanisms and their implications in human health.
