Analytical Data
-
Gene name
speB
- Application
-
Alternative Names
speB；GDAH；Guanidino acid hydrolase. mitochondrial
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
B7LFJ6
-
Expression Region
1-306aa
-
AA Sequence
MSTLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIRQVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRMLSFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPNHSVQIGIRTEFDIDNGFTVLDACQVNDRSVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAPGTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQAAKKGE
-
Molecular Weight
49.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of recombinant SpeB (Streptococcus pyogenes endopeptidase B) is significant due to its role in the pathogenesis of Streptococcus pyogenes, a bacterium responsible for various human diseases, including pharyngitis, scarlet fever, and severe invasive infections like necrotizing fasciitis. SpeB is a cysteine protease that is secreted by the bacteria and plays a crucial role in the breakdown of host tissues, immune evasion, and modulation of inflammation. Understanding the mechanisms of SpeB activity and regulation is essential for developing targeted therapeutic strategies and vaccines. The recombinant production of SpeB allows for detailed structural and functional studies, enabling researchers to investigate its enzymatic properties, substrate specificity, and interactions with host immune components. By utilizing recombinant DNA technology, scientists can produce significant amounts of purified SpeB for biochemical assays and potential applications in diagnostics or therapeutics. Furthermore, studying the potential inhibition of SpeB activity may provide insights into novel antimicrobial strategies against S. pyogenes infections, which remain a significant public health concern globally. This research is crucial for advancing our knowledge of bacterial virulence factors and for exploring avenues to mitigate the impact of Streptococcus pyogenes-related diseases.
