Analytical Data
-
Gene name
STEAP1
- Application
-
Alternative Names
STEAP1；PRSS24；STEAP；STEAP1 Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UHE8
-
Expression Region
1-339aa
-
AA Sequence
MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
-
Molecular Weight
41.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
STEAP1 (six-transmembrane epithelial antigen of prostate 1) is an integral membrane protein that has gained significant interest due to its prominent role in cancer biology, particularly in prostate cancer. As a member of the STEAP family, STEAP1 is characterized by its six transmembrane domains and is primarily expressed in prostate tissues, making it a potential biomarker for prostate cancer diagnosis and therapy. Research has revealed that STEAP1 is involved in various cellular processes, including iron metabolism and cellular differentiation, which are crucial for tumor progression. The overexpression of STEAP1 in malignant tissues compared to normal epithelial cells suggests its potential as a therapeutic target. Recombinant STEAP1 proteins have been developed for further investigation into its biological functions, interactions, and potential as a target for immunotherapy. Studies on STEAP1 recombinant proteins have focused on understanding its structure-function relationship and elucidating mechanisms of action in cancer cells. These efforts aim to pave the way for novel therapeutic strategies, including monoclonal antibodies or vaccine-based approaches that could lead to more effective treatments for prostate cancer. Additionally, the study of STEAP1 offers insights into potential pathways that could be exploited in targeting other malignancies where STEAP proteins are implicated, thus broadening the scope of applications for STEAP1-related research. Overall, the investigation of recombinant STEAP1 proteins stands at the intersection of cancer biology and therapeutic innovation, highlighting its significance in the ongoing effort to develop targeted cancer therapies.
