Analytical Data
-
Gene name
PPYR1
- Application
-
Alternative Names
NPY4R; PPYR1; Neuropeptide Y receptor type 4; NPY4-R; Pancreatic polypeptide receptor 1; PP1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P50391
-
AA Sequence
MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNLCLMCVTVRQKEKANVTNLLIANLAFSDFLMCLLCQPLTAVYTIMDYWIFGETLCKMSAFIQCMSVTVSILSLVLVALERHQLIINPTGWKPSISQAYLGIVLIWVIACVLSLPFLANSILENVFHKNHSKALEFLADKVVCTESWPLAHHRTIYTTFLLLFQYCLPLGFILVCYARIYRRLQRQGRVFHKGTYSLRAGHMKQVNVVLVVMVVAFAVLWLPLHVFNSLEDWHHEAIPICHGNLIFLVCHLLAMASTCVNPFIYGFLNTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTEVSKGSLRLSGRSNPI
-
Molecular Weight
42.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPYR1, or the neuropeptide Y receptor type 1, is part of the G-protein coupled receptor (GPCR) family and plays a crucial role in various physiological processes, including appetite regulation, circadian rhythm, and anxiety. Given its significant involvement in the central nervous system, PPYR1 has emerged as a potential therapeutic target for conditions such as obesity, stress-related disorders, and metabolic syndromes. The study of PPYR1 recombinant protein is critical for understanding its structure-function relationship and the molecular mechanisms underlying its signaling pathways. Through recombinant protein technology, researchers can produce PPYR1 in a controlled manner, facilitating the study of its biochemical properties, ligand binding characteristics, and interactions with other cellular proteins. This research is vital for developing drugs that could modulate PPYR1 activity, potentially leading to novel treatments for related health issues. Moreover, understanding the nuances of PPYR1's function via recombinant proteins can offer insights into GPCR biology in general, as this receptor family represents a significant portion of pharmacological targets in drug development. As such, advancements in the production and characterization of PPYR1 recombinant proteins will enhance our knowledge of this important receptor and support the design of innovative therapeutic strategies.
