Analytical Data
-
Gene name
TES
- Application
-
Alternative Names
TES；Testin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UGI8
-
Expression Region
1-421aa
-
AA Sequence
MDLENKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEEDRKVGKLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRMS
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TES (testis-expressed gene) proteins, particularly TES and its related isoforms, are of significant interest in the field of molecular biology due to their crucial roles in reproductive biology and potential implications in various diseases, including cancer. Initially identified in testicular tissues, TES proteins have been shown to participate in critical cellular processes such as cell adhesion, migration, and differentiation. Research has indicated that altered expression of TES proteins may correlate with tumor progression and metastasis, making them potential biomarkers for cancer diagnosis and prognosis. Additionally, TES proteins have been implicated in the regulation of spermatogenesis and development of male germ cells, highlighting their importance in fertility and reproductive health. The intricate mechanisms by which TES proteins exert their functions are an active area of investigation, with studies focusing on their structure, downstream signaling pathways, and interactions with other proteins. Furthermore, the potential application of TES proteins in targeted therapies and regenerative medicine underscores the need for comprehensive research in this domain. As scientists continue to unravel the complexities surrounding TES proteins, their relevance in both fundamental biology and clinical applications becomes increasingly evident, paving the way for innovative strategies in disease management and reproductive health.
