Analytical Data
-
Gene name
EXTL2
- Application
-
Alternative Names
EXTL2；EXTR2；Exostosin-like 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBQ6
-
Expression Region
1-330aa
-
AA Sequence
MRCCHICKLPGRVMGIRVLRLSLVVILVLLLVAGALTALLPSVKEDKMLMLRREIKSQGKSTMDSFTLIMQTYNRTDLLLKLLNHYQAVPNLHKVIVVWNNIGEKAPDELWNSLGPHPIPVIFKQQTANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEMQAPGSGNGDQYSMVLIGASFFNSKYLELFQRQPAAVHALIDDTQNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGYSGMWHRAEHALQRSYCINKLVNIYDSMPLRYSNIMISQFGFPYANYKRKI
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EXTL2 (Extracellular Matrix Glycoprotein 2) is a gene that encodes a membrane-associated protein involved in the synthesis and organization of extracellular matrix components, particularly heparan sulfate proteoglycans. Research into EXTL2 has gained attention due to its potential role in various biological processes, such as cell adhesion, migration, and signaling, which are crucial for development and tissue homeostasis. Moreover, alterations in EXTL2 expression have been implicated in pathological conditions, including cancers and developmental disorders. Studies have shown that EXTL2 may influence tumor progression and metastasis by modulating the tumor microenvironment and interactions between cancer cells and surrounding stromal cells. Understanding the molecular mechanisms underlying EXTL2 function may provide insights into its role in disease and potentially identify novel therapeutic targets. The exploration of EXTL2 is also relevant to regenerative medicine and tissue engineering, where the manipulation of extracellular matrix components is essential for successful tissue repair and regeneration. Therefore, ongoing research aims to elucidate the specific functions of EXTL2, its interactions with other proteins, and its regulatory pathways to better understand its contributions to health and disease.
