Cat: PA1000-4237

Recombinant Human CHRNB3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CHRNB3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CHRNB3;Neuronal acetylcholine receptor subunit beta-3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q05901

  • Expression Region

    25-232aa

  • AA Sequence

    IAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDEKNQL MTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGR FEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSW TYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFIT YSFVLRRLLDHHHHHH

  • Molecular Weight

    25 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The CHRNB3 gene encodes a subunit of the nicotinic acetylcholine receptor (nAChR), which plays a critical role in neurotransmission in the nervous system. The nAChRs are pentameric ligand-gated ion channels that mediate fast synaptic transmission and are involved in various physiological processes, including muscle contraction, cognitive function, and modulation of neurotransmitter release. Research has indicated that variations in CHRNB3 are associated with susceptibility to nicotine addiction and other neuropsychiatric disorders. The investigation of CHRNB3 recombinant proteins is vital for understanding the structural and functional properties of nAChRs, which could reveal insights into the mechanisms underlying nicotine dependence and guide the development of therapeutic strategies. Moreover, the study of CHRNB3 may also contribute to drug discovery efforts aimed at targeting specific receptor subtypes for treating neurological diseases. The expression and purification of CHRNB3 recombinant proteins allow researchers to explore their functional dynamics, pharmacological profiles, and interactions with ligands or potential drugs. This research not only enhances our comprehension of receptor biology but also holds promise for informing pharmaceuticals designed to modulate these receptors in clinical settings.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US