Analytical Data
-
Gene name
CHRNB3
- Application
-
Alternative Names
CHRNB3；Neuronal acetylcholine receptor subunit beta-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q05901
-
Expression Region
25-232aa
-
AA Sequence
IAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDEKNQL MTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGR FEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSW TYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFIT YSFVLRRLLDHHHHHH
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The CHRNB3 gene encodes a subunit of the nicotinic acetylcholine receptor (nAChR), which plays a critical role in neurotransmission in the nervous system. The nAChRs are pentameric ligand-gated ion channels that mediate fast synaptic transmission and are involved in various physiological processes, including muscle contraction, cognitive function, and modulation of neurotransmitter release. Research has indicated that variations in CHRNB3 are associated with susceptibility to nicotine addiction and other neuropsychiatric disorders. The investigation of CHRNB3 recombinant proteins is vital for understanding the structural and functional properties of nAChRs, which could reveal insights into the mechanisms underlying nicotine dependence and guide the development of therapeutic strategies. Moreover, the study of CHRNB3 may also contribute to drug discovery efforts aimed at targeting specific receptor subtypes for treating neurological diseases. The expression and purification of CHRNB3 recombinant proteins allow researchers to explore their functional dynamics, pharmacological profiles, and interactions with ligands or potential drugs. This research not only enhances our comprehension of receptor biology but also holds promise for informing pharmaceuticals designed to modulate these receptors in clinical settings.
