Cat: PA2000-1876

Recombinant Human APH1a Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    APH1a

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    APH1a;PSF;Gamma-secretase subunit APH-1A

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96BI3

  • Expression Region

    235-265aa

  • AA Sequence

    SLRSIQRSLLCRRQEDSRVMVYSALRIPPED

  • Molecular Weight

    11.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

APH1a (anterior pharynx 1a) is a crucial component of the gamma-secretase complex, a multifunctional protease integral to the regulation of various cellular processes, including the cleavage of type I membrane proteins. Research on APH1a has gained prominence due to its pivotal role in Alzheimer's disease, where dysregulation of gamma-secretase activity leads to the aberrant processing of the amyloid precursor protein (APP) and the consequent accumulation of amyloid-beta peptides, key pathological hallmarks of the disease. Understanding the structure, function, and molecular interactions of APH1a is vital for elucidating its contributions to gamma-secretase activity and its implications in neurodegenerative disorders. Genetic studies have identified APH1a as a potential genetic risk factor for Alzheimer's disease, bolstering interest in its recombinant protein form for further investigations. The study of APH1a recombinant protein provides insights into its biochemistry, interaction partners, and regulatory mechanisms, paving the way for developing targeted therapeutic strategies that could mitigate the effects of gamma-secretase dysregulation in Alzheimer's and possibly other diseases. Through biochemical assays, structural biology, and cell-based models, researchers aim to delineate the functional roles of APH1a and enhance our understanding of its contribution to cellular homeostasis and disease pathology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US