Analytical Data
-
Gene name
APH1a
- Application
-
Alternative Names
APH1a；PSF；Gamma-secretase subunit APH-1A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96BI3
-
Expression Region
235-265aa
-
AA Sequence
SLRSIQRSLLCRRQEDSRVMVYSALRIPPED
-
Molecular Weight
11.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
APH1a (anterior pharynx 1a) is a crucial component of the gamma-secretase complex, a multifunctional protease integral to the regulation of various cellular processes, including the cleavage of type I membrane proteins. Research on APH1a has gained prominence due to its pivotal role in Alzheimer's disease, where dysregulation of gamma-secretase activity leads to the aberrant processing of the amyloid precursor protein (APP) and the consequent accumulation of amyloid-beta peptides, key pathological hallmarks of the disease. Understanding the structure, function, and molecular interactions of APH1a is vital for elucidating its contributions to gamma-secretase activity and its implications in neurodegenerative disorders. Genetic studies have identified APH1a as a potential genetic risk factor for Alzheimer's disease, bolstering interest in its recombinant protein form for further investigations. The study of APH1a recombinant protein provides insights into its biochemistry, interaction partners, and regulatory mechanisms, paving the way for developing targeted therapeutic strategies that could mitigate the effects of gamma-secretase dysregulation in Alzheimer's and possibly other diseases. Through biochemical assays, structural biology, and cell-based models, researchers aim to delineate the functional roles of APH1a and enhance our understanding of its contribution to cellular homeostasis and disease pathology.
