Analytical Data
-
Gene name
PLAAT3
- Application
-
Alternative Names
PLAAT3；HRASLS3；Phospholipase A and acyltransferase 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P53816
-
Expression Region
1-162aa
-
AA Sequence
MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PLAAT3, or Phospholipase A and Acyltransferase 3, is a member of the phospholipase A (PLA) superfamily and has garnered significant interest due to its potential roles in lipids metabolism and cell signaling. Understanding the function and structure of PLAAT3 is crucial, as it may play a vital role in various biological processes, including inflammation, apoptosis, and cancer progression. Previous studies suggest that PLAAT3 may influence membrane dynamics and the availability of lipid mediators, which are essential for many cellular functions. Its unique enzymatic activities, including the hydrolysis and acylation of glycerophospholipids, position PLAAT3 as a key player in lipid turnover and homeostasis. Given the increasing evidence linking dysregulated lipid metabolism to various diseases, researchers are focusing on the characterization of PLAAT3 to explore its potential as a therapeutic target. Advanced techniques, including recombinant protein expression and purification, are employed to study its biochemical properties and interactions with other biomolecules. The exploration of PLAAT3 not only enhances our understanding of lipid biology but also opens avenues for novel interventions in lipid-associated diseases, making it a promising subject of contemporary biomedical research.
