Analytical Data
-
Gene name
GCSF
- Application
-
Alternative Names
GCSF；C17orf33；Granulocyte colony-stimulating factor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P09919
-
Expression Region
31-207aa
-
AA Sequence
TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEEL VLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISP ELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRR AGGVLVASHLQSFLEVSYRVLRHLAQP
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Granulocyte colony-stimulating factor (GCSF) is a crucial hematopoietic growth factor that plays a significant role in the stimulation and proliferation of granulocyte precursors in the bone marrow, leading to increased production of neutrophils. Its recombinant form, known as recombinant human GCSF (rhGCSF), has been extensively researched and utilized in clinical settings, particularly for patients undergoing chemotherapy, those with congenital neutropenia, and individuals at risk of infections due to bone marrow disorders. The background of GCSF research is rooted in its discovery in the late 1980s, when scientists identified its potential to mobilize hematopoietic stem cells and enhance immune responses. Subsequent studies delineated its mechanism of action, primarily through binding to specific receptors on progenitor cells, thereby triggering intracellular signaling pathways that promote cell survival, differentiation, and maturation. Over the years, various formulations of rhGCSF, such as pegylated forms, have been developed to improve pharmacokinetics and patient compliance. Research has also expanded into understanding GCSF's broader implications beyond hematopoiesis, including its role in tissue repair, inflammation modulation, and neuroprotection. As the understanding of GCSF continues to evolve, new therapeutic applications and potential combinations with other treatments are being explored, highlighting its importance not only in hematology but also in various other medical fields. Overall, GCSF remains a vital component in modern medicine, illustrating the significant impact of biotechnology on human health.
