Analytical Data
-
Gene name
PPP1R3A
- Application
-
Alternative Names
Glycogen and sarcoplasmic reticulum binding subunit. skeletal muscle; Glycogen associated regulatory subunit of protein phosphatase 1; GM; PP1G; PPP1R3; PPP1R3A; PPR3A_HUMAN; Protein phosphatase 1 glycogen-associated regulatory subunit; Protein phosphatase 1 glycogen-targeting subunit. muscle; Protein phosphatase 1 regulatory subunit 3A; Protein phosphatase 1 regulatory subunit GM; protein phosphatase 1. regulatory (inhibitor) subunit 3A; Protein phosphatase 1. regulatory subunit 3; Protein phosphatase type-1 glycogen targeting subunit; RG1; Serine /threonine specific protein phosphatase; Type 1 protein phosphatase skeletal muscle glycogen targeting subunit
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16821
-
Expression Region
1-101 aa
-
AA Sequence
PSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSEDIYLDTPSSGTRRVSFADSFGFNLVSVKEFDCWELPSASTTFDLGTDIFHT
-
Molecular Weight
36.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPP1R3A, also known as protein phosphatase 1 regulatory subunit 3A, plays a crucial role in the regulation of protein phosphatase 1 (PP1), a serine/threonine phosphatase involved in various cellular processes including metabolism, cell division, and signal transduction. The regulation of PP1 by PPP1R3A specifically influences glycogen metabolism, as it helps mediate the dephosphorylation of key enzymes involved in glycogen synthesis and breakdown. Alterations in PPP1R3A expression or function have been linked to metabolic disorders such as obesity and diabetes, highlighting its potential as a therapeutic target. Researchers are focusing on the structure-function relationship of PPP1R3A to understand its interaction with PP1 and other cellular partners, which may lead to the development of novel strategies for modulating PP1 activity. Understanding the mechanisms by which PPP1R3A regulates PP1 is essential for exploring its implications in diseases related to energy metabolism and insulin signaling. Recombinant PPP1R3A proteins are crucial for these studies, as they provide a tool for biochemical assays and structural analyses that can elucidate its regulatory mechanisms and potential roles in human health and disease.
