Analytical Data
-
Gene name
RNASEK
- Application
-
Alternative Names
RNASEK；Ribonuclease kappa
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6P5S7
-
Expression Region
1-137aa
-
AA Sequence
MGWLRPGPRPLCPPARASWAFSHRFPSPLAPRRSPTPFFMASLLCCGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYNLYEQVSYNCFIAAGLYLLLGGFSFCQVRLNKRKEYMVR
-
Molecular Weight
15.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RNASEK, short for ribonuclease kinase, is a distinctive enzyme that plays a crucial role in RNA metabolism. It is involved in the phosphorylation of ribonucleases, which are essential for RNA degradation and turnover within the cell. Research into RNASEK has gained momentum due to its potential implications in various biological processes and diseases, including cancer and viral infections, where the manipulation of RNA levels can significantly impact health. Moreover, RNASEK's unique mechanism of action and substrate specificity allow for deeper insights into RNA processing and regulation. Understanding the structure and function of RNASEK not only broadens our comprehension of cellular RNA dynamics but also opens avenues for biotechnological applications, such as developing novel therapeutic strategies. The study of RNASEK is therefore pivotal, as it bridges fundamental cellular biology with potential clinical advancements, paving the way for innovative treatments targeting RNA metabolism. As researchers delve into the intricate workings of RNASEK, they aim to elucidate its regulatory mechanisms and explore its interactions with other cellular components, contributing to a comprehensive understanding of RNA biology and its relevance in health and disease.
