Analytical Data
-
Gene name
C11orf87
- Application
-
Alternative Names
C11orf87Uncharacterized Protein C11orf87
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6NUJ2
-
Expression Region
1-197aa
-
AA Sequence
MSARAPKELRLALPPCLLNRTFASPNASGSGNTGARGPGAVGSGTCITQVGQQLFQSFSSTLVLIVLVTVIFCLIVLSLSTFHIHKRRMKKRKMQRAQEEYERDHCSGSRGGGGLPRPGRQAPTHAKETRLERQPRDSPFCAPSNASSLSSSSPGLPCQGPCAPPPPPPASSPQGAHAASSCLDTAGEGLLQTVVLS
-
Molecular Weight
47 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C11orf87, also known as the "Oligophrenin-1 domain containing protein," has gained attention in recent years due to its potential role in various biological processes and its implications in human health. This gene encodes a protein that is believed to be involved in cellular signaling and may play a role in neurodevelopmental disorders, as aberrations in its expression have been associated with cognitive impairments. Initial studies have suggested that C11orf87 may be involved in pathways related to neuron growth and differentiation, making it a candidate for research in neurogenetics and mental health. Furthermore, investigations into the structural and functional properties of the C11orf87 recombinant protein are crucial for understanding its mechanistic role in these processes. By elucidating the biochemical characteristics and interactions of this protein, researchers aim to clarify its involvement in disease conditions and explore its potential as a therapeutic target. Given the complexities associated with neurodevelopment, the study of C11orf87 presents an exciting opportunity to contribute to the broader understanding of the molecular underpinnings of brain function and dysfunction.
