Analytical Data
-
Gene name
PVRIG
- Application
-
Alternative Names
PVRIG；C7orf15；Transmembrane Protein PVRIG
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6DKI7
-
Expression Region
41-171aa
-
AA Sequence
TPEVWVQVRMEATELSSFTIRCGFLGSGSISLVTVSWGGPNGAGGTTLAV LHPERGIRQWAPARQARWETQSSISLILEGSGASSPCANTTFCCKFASFP EGSWEACGSLPPSSDPGLSAPPTPAPILRAD
-
Molecular Weight
40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PVRIG (Programmed Cell Death Protein 1 Ligand 2) is an immune checkpoint protein that plays a crucial role in the regulation of T-cell responses in the tumor microenvironment. Its expression is often upregulated in various cancers, contributing to immune evasion and tumor progression. Research on PVRIG's structure and function has gained momentum due to its potential as a therapeutic target for cancer immunotherapy. The understanding of PVRIG's mechanisms of action, particularly its interactions with receptors on T-cells, could pave the way for the development of novel immunomodulatory treatments. Furthermore, the recombinant production of PVRIG protein enables detailed biochemical studies and the exploration of its role in immune regulation. By generating and characterizing PVRIG recombinants, scientists aim to elucidate its binding affinities, signaling pathways, and overall impact on immune cell functionality. This research is critical not only for advancing our understanding of immune checkpoints but also for enhancing the efficacy of existing immunotherapies and potentially overcoming resistance mechanisms in cancer treatment. As the field progresses, targeting PVRIG in conjunction with other immune checkpoints may offer synergistic effects that could lead to more effective therapeutic strategies in oncology.
