Analytical Data
-
Gene name
SLAMF5
- Application
-
Alternative Names
SLAMF5；SLAMF5；SLAM family member 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UIB8
-
Expression Region
22-225aa
-
AA Sequence
KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETA PVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTT KRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPL GEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRT HHTG
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLAMF5, a member of the SLAM (Signaling Lymphocyte Activation Molecule) family, plays a crucial role in immune regulation and the activation of lymphocytes. Research into SLAMF5 recombinant proteins is driven by the need to understand its function in various diseases, particularly in the context of autoimmune disorders and cancer. SLAMF5 is primarily expressed on the surface of immune cells such as T cells and B cells, where it participates in cell signaling pathways that modulate immune responses. Recent studies suggest that dysregulation of SLAMF5 can lead to enhanced autoimmune activity or impaired tumor immunity, making it a compelling target for therapeutic intervention. By producing recombinant SLAMF5 proteins, researchers aim to characterize its structural properties and signaling mechanisms, which could facilitate the development of novel immunotherapies. Additionally, studying SLAMF5 interactions with other immune modulators may unveil new insights into the complex network of immune regulation. Understanding these dynamics is essential for designing strategies to enhance immune responses against tumors or mitigate excessive responses in autoimmune diseases. Overall, SLAMF5 recombinant protein research represents a significant avenue for advancing our understanding of immune system functionality and developing innovative treatment options.
