Cat: PA2000-1863

Recombinant Human GPR157 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GPR157

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GPR157;G-Protein coupled receptor 157

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q5UAW9

  • Expression Region

    1-335aa

  • AA Sequence

    MQPSPPPTELVPSERAVVLLSCALSALGSGLLVATHALWPDLRSRARRLL LFLSLADLLSAASYFYGVLQNFAGPSWDCVLQGALSTFANTSSFFWTVAI ALYLYLSIVRAARGPRTDRLLWAFHVVSWGVPLVITVAAVALKKIGYDAS DVSVGWCWIDLEAKDHVLWMLLTGKLWEMLAYVLLPLLYLLVRKHINRAH TALSEYRPILSQEHRLLRHSSMADKKLVLIPLIFIGLRVWSTVRFVLTLC GSPAVQTPVLVVLHGIGNTFQGGANCIMFVLCTRAVRTRLFSLCCCCCSS QPPTKSPAGTPKAPAPSKPGESQESQGTPGELPST

  • Molecular Weight

    39 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GPR157, a G protein-coupled receptor (GPCR), has gained attention in recent years due to its potential roles in various physiological processes and its implications in neuropsychiatric disorders. This receptor is primarily expressed in the central nervous system and has been linked to the modulation of neurodevelopment and synaptic plasticity. Research indicates that alterations in GPR157 expression may be associated with conditions such as anxiety, depression, and schizophrenia, highlighting its significance in mental health. Additionally, GPR157's unique ligand-binding properties and interaction with different signaling pathways make it a promising target for drug development. The recombinant expression of GPR157 protein is crucial for elucidating its structure-function relationship and for conducting functional assays to investigate its signaling mechanisms. Understanding the intricate role of GPR157 in neural processes not only enhances our fundamental knowledge of GPCR biology but also paves the way for the development of novel therapeutic strategies for treating neuropsychiatric disorders. This research thereby signifies the importance of GPR157 as a focal point for both basic and translational studies aimed at improving mental health outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US