Analytical Data
-
Gene name
CCL8
- Application
-
Alternative Names
CCL8；MCP2；C-C motif chemokine 8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P80075
-
Expression Region
24-99aa
-
AA Sequence
QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKE VCADPKERWVRDSMKHLDQIFQNLKP
-
Molecular Weight
9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCL8, also known as Monocyte Chemoattractant Protein-2 (MCP-2), is a member of the CC chemokine family that plays a pivotal role in the immune response by attracting monocytes and other immune cells to sites of inflammation. This chemokine is primarily produced by macrophages and is implicated in various pathological conditions, including autoimmune diseases, cancer, and chronic inflammatory disorders. Studies have shown that CCL8 not only influences the recruitment of immune cells but also modulates their activities, contributing to both pro-inflammatory and anti-inflammatory responses. The interest in recombinant CCL8 protein has surged, driven by its potential as a therapeutic target and biomarker for disease progression. Researchers have aimed to produce and characterize recombinant CCL8 to investigate its biological functions and interactions with other immune modulators. Furthermore, understanding the signaling pathways activated by CCL8 can provide insights into its role in the immune system and its potential role in therapeutic interventions. Given its involvement in critical immune processes, recombinant CCL8 protein serves as a valuable tool for elucidating the molecular mechanisms underlying immune regulation and developing novel treatments for immune-related diseases. Overall, the study of CCL8 holds promise for advancing our understanding of immune responses and enhancing therapeutic strategies in various clinical settings.
