Analytical Data
-
Gene name
ANGPTL4
- Application
-
Alternative Names
ANGPTL4；ARP4；；Angiopoietin-related Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BY76
-
Expression Region
166-406aa
-
AA Sequence
PEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVN CKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSI TGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGAT TVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFR SIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Angiopoietin-like 4 (ANGPTL4) is a secreted glycoprotein implicated in a variety of physiological and pathological processes, particularly in metabolism, inflammation, and tumor biology. Initially identified as a regulator of angiogenesis, ANGPTL4 is now known to play critical roles in lipid metabolism by inhibiting lipoprotein lipase, thereby affecting triglyceride levels in the bloodstream. This is particularly relevant in metabolic disorders such as obesity and diabetes. Additionally, ANGPTL4 has been associated with cancer progression and metastasis, highlighting its potential as a therapeutic target. Studies have shown that ANGPTL4 expression levels can be modulated by various factors, including hypoxia and inflammatory cytokines, indicating its role in adaptive responses to tissue microenvironments. The recombinant protein variant of ANGPTL4 has garnered attention for its potential applications in both diagnostics and therapeutics. Understanding the precise mechanisms of ANGPTL4 action through recombinant protein studies can provide insights into its multifaceted roles and open avenues for novel interventions in metabolic and oncological diseases. Given the increasing prevalence of related health issues, ongoing research aims to elucidate the signaling pathways and interaction networks associated with ANGPTL4, which may ultimately facilitate the development of more effective treatments and management strategies.
