Analytical Data
-
Gene name
VACWR090
- Application
-
Alternative Names
VACWR090；Protein OPG097
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P07614
-
Expression Region
1-350aa
-
AA Sequence
MNTRTDVTNDNIDKNPTKRGDKNIPGRNERFNDQNRFNNDIPKPKPRLQPNQPPKQDNKCREENGDFINIRLCAYEKEYCNDGYLSPAYYMLKQVDDEEMSCWSELSSLVRSRKAVGFPLLKAAKRISHGSMLYFEQFKNSKVVRLTPQVKCLNDTVIFQTVVILYSMYKRGIYSNEFCFDLVSIPRTNIVFSVNQLMFNICTDILVVLSICGNRLYRTNLPQSCYLNFIHGHETIARRGYEHSNYFFEWLIKNHISLLTKQTMDILKVKKKYAIGAPVNRLLEPGTLVYVPKEDYYFIGISLTDVSISDNVRVLFSTDGIVLEIEDFNIKHLFMAGEMFVRSQSSTIIV
-
Molecular Weight
42.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VACWR090 is a recombinant protein derived from the Vaccinia virus, which has garnered significant interest in the field of virology and immunology due to its potential applications in vaccine development and therapeutic interventions. Vaccinia virus, a member of the poxvirus family, is historically known for its role in the smallpox vaccination, and its ability to elicit robust immune responses makes it a valuable model for studying viral pathogenesis and host interactions. The VACWR090 protein serves as a critical component for understanding how the Vaccinia virus modulates host immune responses, particularly through its impact on cytokine signaling pathways. Research into VACWR090 has also focused on its ability to subvert innate immune mechanisms, which may provide insights into the development of broad-spectrum antiviral strategies. Additionally, as the world faces emerging infectious diseases, there is a pressing need to explore innovative approaches to vaccine design, where VACWR090 could play a pivotal role in stimulating effective adaptive immune responses. Understanding its structure, function, and interactions with host immune components is essential for leveraging this protein in therapeutic applications and advancing our knowledge of host-pathogen dynamics. Hence, ongoing studies on VACWR090 not only aim to elucidate its biological significance but also strive to enhance the efficacy of vaccines against various viral pathogens, highlighting its potential as a promising candidate in the fight against infectious diseases.
