Analytical Data
-
Gene name
CECD
- Application
-
Alternative Names
CECD;Cecropin-D
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O76146
-
Expression Region
25-60aa
-
AA Sequence
GNFFKDLEKMGQRVRDAVISAAPAVDTLAKAKALGQ
-
Molecular Weight
7.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on CECD (Cysteine-rich EGF-like domain Containing protein) recombinant proteins has garnered significant attention due to their potential applications in various biomedical fields. CECD proteins, characterized by their unique cysteine-rich EGF-like domains, play pivotal roles in cellular growth, differentiation, and signaling pathways. Understanding the structure and function of CECD proteins is essential for exploring their implications in developmental processes and disease mechanisms, particularly in cancer and cardiovascular diseases. The ability to produce recombinant CECD proteins using techniques such as recombinant DNA technology offers valuable tools for in-depth functional studies and therapeutic development. Moreover, the study of CECD proteins facilitates the understanding of their interactions with other biomolecules, which can lead to novel biomarker discoveries and the design of targeted therapies. As research progresses, the potential for CECD recombinant proteins to be utilized in drug delivery systems and regenerative medicine further underscores their importance in modern science and medicine.











