Analytical Data
-
Gene name
PPP1R12B
- Application
-
Alternative Names
PPP1R12B; MYPT2; Protein phosphatase 1 regulatory subunit 12B; Myosin phosphatase-targeting subunit 2; Myosin phosphatase target subunit 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60237
-
Expression Region
1-386 aa
-
AA Sequence
MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGAVFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAGYELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLELLQKKQNVLRSEKETRNKLIESDLNSKIQSGFFKNKEKMLYEEETPKSQEMEEENKESSSSSSEEEEGEDEASESETEKEAVLFWPF
-
Molecular Weight
69.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPP1R12B, also known as protein phosphatase 1 regulatory subunit 12B, plays a crucial role in the regulation of protein phosphatase 1 (PP1), an essential enzyme involved in various cellular processes, including cell division, muscle contraction, and neuronal signaling. As a regulatory subunit, PPP1R12B modulates PP1 activity, influencing numerous downstream signaling pathways and processes. Research into PPP1R12B has gained momentum due to its implications in several diseases, including cancer and neurodegenerative disorders. Alterations in its expression or function can disrupt normal cellular signaling, leading to aberrant cell proliferation and survival. Therefore, understanding the structure and function of PPP1R12B, particularly through recombinant protein studies, is vital for elucidating its role in cellular mechanisms and its potential as a therapeutic target. The use of recombinant DNA technologies allows for the expression and purification of PPP1R12B, providing a platform for detailed biochemical characterization and functional assays. These studies could reveal critical insights into how PPP1R12B interacts with PP1 and other cellular partners, further expanding our understanding of its biological significance and potential applications in disease intervention.
