Analytical Data
-
Gene name
yopE
- Application
-
Alternative Names
yopE;yop25;Outer membrane virulence Protein YopE
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P31492
-
Expression Region
1-219aa
-
AA Sequence
MKISSFISTSLPLPASVSGSSSVGEMSGRSVSQQKSDQYANNLAGRTESPQGSSLASRIIERLSSMAHSVIGFIQRMFSEGSHKPVVTPALTPAQMPSPTSFSDSIKQLAAETLPKYMQQLSSLDAETLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTVGGAASAYVASGVDLTQAANEIKGLGQQMQQLLSLM
-
Molecular Weight
26.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
YopE is a virulence factor secreted by Yersinia pestis, the causative agent of plague, and by other Yersinia species, including Yersinia enterocolitica and Yersinia pseudotuberculosis. This protein plays a crucial role in the pathogenicity of these bacteria by disrupting host immune responses, particularly through its function as a Rho GTPase-activating protein (GAP). By inactivating Rho family GTPases, YopE can hinder phagocytosis and alter cytoskeletal dynamics in host cells, thus facilitating bacterial survival and dissemination. Research on recombinant YopE protein has gained significance for understanding the molecular mechanisms underlying Yersinia virulence and host-pathogen interactions. Additionally, the study of YopE has potential implications for vaccine development and the design of therapeutic strategies aimed at countering Yersinia infections. The recombinant production of YopE enables detailed biochemical studies and structural analyses, providing insights into its function and interactions with cellular targets. Moreover, as the prevalence of antibiotic-resistant strains poses a significant challenge in treating Yersinia infections, understanding YopE's role could guide the development of alternative treatment approaches. Therefore, the investigation of YopE's properties and mechanisms not only enhances our understanding of Yersinia pathogenesis but also contributes to broader efforts in infectious disease research.











