Cat: PA1000-4154

Recombinant Human INSL3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    INSL3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    INSL3;RLF;;Insulin-like 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P51460

  • Expression Region

    21-131aa

  • AA Sequence

    LGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWL ERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGC TQQDLLTLCPYVDHHHHHH

  • Molecular Weight

    13 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

INSL3, or Insulin-like 3, is a peptide hormone that plays a critical role in male reproductive function, particularly in regulating testicular descent and the development of the male reproductive system. Discovered in the early 1990s, INSL3 is primarily produced by Leydig cells in the testes and is essential for normal gonadal development and function. Research on INSL3 has gained momentum due to its implications in various medical conditions, such as cryptorchidism (undescended testis) and infertility. Understanding the molecular mechanisms behind INSL3 signaling may provide insights into developmental disorders and potential therapeutic targets. Moreover, its role as a biomarker in reproductive health has been explored, with studies indicating that altered levels of INSL3 may be associated with conditions like hormonal imbalances and testicular tumors. Recent advancements in recombinant protein technology have facilitated the production of biologically active INSL3, enabling in-depth studies of its biological functions and interactions. This research trajectory not only enhances our understanding of male reproductive physiology but also contributes to developing novel diagnostic and therapeutic strategies for related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US