Analytical Data
-
Gene name
Pret-110
- Application
-
Alternative Names
Pret-110；
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0C9Y3
-
Expression Region
1-61aa
-
AA Sequence
MALDGSSGGGSNVETLLIVAIIVVIMAIMLYYFWWMPRQQKKCSKAEECTCNNGSCSLKTS
-
Molecular Weight
6.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Pret-110, a recombinant protein derived from a specific pathogen or organism, has garnered significant attention in the field of molecular biology and biotechnology due to its potential applications in various therapeutic and diagnostic contexts. Research into Pret-110 aims to elucidate its structural and functional characteristics, which can provide insights into its biological mechanisms and interactions within cellular environments. The growing interest in recombinant proteins, particularly those like Pret-110, stems from their ability to serve as biomarkers, therapeutic agents, or components in vaccine development. The study of Pret-110 also addresses the challenges of producing proteins with high purity and activity while minimizing potential immunogenicity. As researchers continue to explore the implications of Pret-110 in areas such as drug delivery systems, oncology, and infectious disease management, understanding its properties and optimizing production processes remain essential. This research is further fueled by advances in recombinant DNA technology and protein engineering, which facilitate the design and synthesis of proteins with enhanced stability and efficacy. Consequently, Pret-110 represents a promising candidate for future biomedical applications, potentially leading to improved clinical outcomes and novel therapeutic strategies.
