Cat: PA1000-4133

Recombinant Human LAMP1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LAMP1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    LAMP1;Lysosome-associated membrane glycoProtein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P11279

  • Expression Region

    29-382aa

  • AA Sequence

    AMFMVKNGNGTACIMANFSAAFSVNYDTKSGPKNMTFDLPSDATVVLNRS SCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLF PNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAY LSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTN GTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLEL HSEGTTVLLFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRAL QATVGNSYKCNAEEHVRVTKAFSVNIFKVWVQAFKVEGGQFGSVEECLLD ENSMVDHHHHHH

  • Molecular Weight

    39 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LAMP1 (Lysosomal Associated Membrane Protein 1) is a membrane glycoprotein predominantly found in the lysosomal membranes, playing a crucial role in lysosomal function, signal transduction, and cell membrane trafficking. Research has highlighted LAMP1's involvement in various cellular processes, including autophagy and immune responses, which are essential for maintaining cellular homeostasis. Its significance is further underscored by associations with several diseases, including lysosomal storage disorders and cancer, where altered LAMP1 expression can affect cellular signaling pathways and tumor progression. The production of recombinant LAMP1 proteins has become a focal point for detailed studies, facilitating the exploration of its structure-function relationships and potential therapeutic applications. By utilizing recombinant DNA technology, scientists can generate LAMP1 in sufficient quantities for biochemical assays, structural analyses, and functional studies. These efforts aim to elucidate the molecular mechanisms underlying LAMP1's role in health and disease, ultimately contributing to the development of targeted therapies that can manipulate lysosomal functions in pathological conditions. Understanding LAMP1 at a molecular level could lead to breakthroughs in treating diseases characterized by lysosomal dysfunction, highlighting its significance in both basic research and translational medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US