Analytical Data
-
Gene name
C11orf46
- Application
-
Alternative Names
ARL14EP; ARF7EP; C11orf46; ARL14 effector Protein; ARF7 effector Protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N8R7
-
Expression Region
1-260aa
-
AA Sequence
MMDPCSVGVQLRTTNECHKTYYTRHTGFKTLQELSSNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFEDLQKSCCDPFNIHKKLAKKNLHVIDLDDATFLSAKFGRQLVPGWKLCPKCTQIINGSVDVDTEDRQKRKPESDGRTAKALRSLQFTNPGRQTEFAPETGKREKRRLTKNATAGSDRQVIPAKSKVYDSQGLLIFSGMDLCDCLDEDCLGCFYACPACGSTKCGAECRCDRKWLYEQIEIEGGEIIHNKHAG
-
Molecular Weight
55.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C11orf46, also known as the "chromosome 11 open reading frame 46," is a gene of increasing interest in biomedical research due to its potential implications in various physiological and pathological processes. This gene is located on chromosome 11 and encodes a protein that has been associated with several cellular functions, including cell proliferation, differentiation, and apoptosis. Recent studies have indicated that C11orf46 may play a role in immune responses and inflammatory diseases, making it a candidate for understanding conditions like autoimmune disorders and cancer. Additionally, the analysis of C11orf46's structure and function could provide insights into its interactions with other cellular proteins, contributing to our understanding of cellular signaling pathways. The generation of recombinant C11orf46 protein enables researchers to study its biological properties in vitro and in vivo, facilitating investigations into its mechanisms of action. Understanding the precise functions of C11orf46 in cellular contexts is crucial for deciphering its overall role in health and disease, potentially leading to novel therapeutic strategies targeting this gene in various medical conditions.
