Analytical Data
-
Gene name
C10orf91
- Application
-
Alternative Names
C10orf91Uncharacterized Protein C10orf91
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5T1B1
-
Expression Region
1-145aa
-
AA Sequence
MWSFLPGAESVSMGPVPGVSSLGACWTHDQDSGRAEDRPQAPRITQYTWVLSFLFTEKPQTRSTSPISHQGQPQTTRALSLRQPQHPSAPASGRPRPPHSSGPDLAEAAPVVDQASQAAGRASSGLGLWEQASVSQGFRNAAFEA
-
Molecular Weight
41.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C10orf91, also known as chromosome 10 open reading frame 91, is a gene that encodes a protein with potential implications in various biological processes and diseases. Recent studies have suggested that C10orf91 might play a role in cellular functions, including immune response and inflammation. Given its involvement in disease mechanisms, particularly in autoimmune disorders and cancer, there has been an increasing interest in understanding the structure and function of the C10orf91 protein. Recombinant protein technology allows for the production of C10orf91 in a controlled laboratory environment, enabling researchers to obtain sufficient quantities for detailed functional studies. By producing this protein recombinantly, scientists can investigate its interactions with other cellular components, elucidate its biological roles, and explore its potential as a therapeutic target or biomarker. Furthermore, studying the post-translational modifications of C10orf91 can provide insights into its stability, activity, and regulatory mechanisms. Overall, the research surrounding C10orf91 recombinant protein is crucial for advancing our knowledge of its physiological significance and applying this knowledge to clinical contexts.
